Chemistry data
- Class
- dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist
- Molecular weight
- 4813.5 g/mol
- Sequence
- YAibEGTFTSDVSSYLEEQAAKEFIAWLVKGRG-OH (39 amino acids; Aib = aminoisobutyric acid at position 2; C-20 fatty diacid conjugated to lysine at position 20)
- Half-life
- approximately 5 days (subcutaneous)
- Routes
- subcutaneous
- Studied doses
- subcutaneous 2.5 mg, 5 mg, 10 mg, 15 mg once weekly
For more than a decade, the biggest lever in metabolic medicine was a single hormone: GLP-1. Tirzepatide pulls two levers at once — GIP and GLP-1 — which is why the first dual incretin agonist ever approved carries a reputation far beyond its class.
The engineering explains the hype. A C-20 fatty diacid strapped to lysine at position 20 lets the molecule brush against albumin, stretching a half-life of roughly five days — long enough for one subcutaneous injection per week, a clear advantage over shorter-acting incretin therapies.
It's also a story that crossed the finish line: approved as Mounjaro and Zepbound for type 2 diabetes and chronic weight management, with the SURPASS and SURMOUNT programs behind it. Read on to see how the mechanisms and the caveats actually stack up.
Regulatory Status
- United States
- Fda Approved
- European Union
- Ema Approved
- United Kingdom
- Mhra Approved
What is this compound?
Start with the molecule itself: a synthetic 39-amino-acid peptide built on the native GIP sequence and dressed in two strategic modifications. An aminoisobutyric acid at position 2 resists enzymatic degradation, while a C-20 fatty diacid on lysine 20 binds albumin and stretches the half-life to about five days.
Eli Lilly developed it — researchers call the result a twincretin. Unlike selective GLP-1 receptor agonists such as semaglutide
Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization or liraglutide, its binding is described as imbalanced and biased, tipping toward GIP receptor signaling while keeping GLP-1 activation clinically meaningful PMID: 32730231 .
The pairing wasn't cosmetic: GIP boosts insulin secretion and shapes how adipocytes handle nutrients, while GLP-1 suppresses glucagon, slows gastric emptying, and reduces appetite through central nervous system pathways. One molecule, two complementary metabolic jobs.
The FDA approved it for two indications: glycemic control in adults with type 2 diabetes, as an adjunct to diet and exercise — marketed as Mounjaro — and chronic weight management in adults with obesity or overweight plus at least one weight-related comorbidity, as Zepbound. The EMA and the UK MHRA approved it too.
Behind those decisions sits scale: the SURPASS program for diabetes and the SURMOUNT program for obesity recruited tens of thousands of participants across multiple phase 3 trials — a foundation that lets us be precise about what the evidence does and doesn't show.
How it works
Tirzepatide works by knocking on two doors at once. Research characterizes it as an imbalanced, biased dual agonist — it engages GIPR and GLP-1R with different potencies and signaling profiles, rather than pushing both with equal force PMID: 32730231 .
The tilt toward GIPR isn't a design quirk: preclinical evidence suggests this preference gives a possible advantage over even-handed dual agonism for glucose and weight control PMID: 34003802 . Where the two receptors diverge is exactly where the compound gets interesting.
At the pancreas, the story is about balance rather than brute force. GIP and GLP-1 receptors together pull a stronger glucose-dependent insulin response from beta cells than either could manage alone, and that glucose-dependency keeps hypoglycemia risk low even when blood sugar runs low.
Glucagon mirrors the picture: GLP-1 receptor activation on alpha cells suppresses glucagon during hyperglycemia, while GIP receptor signaling preserves appropriate glucagon responses during hypoglycemia — a balanced counter-regulatory profile PMID: 21984584 . That safety net matters when insulin enters the conversation.
Beyond the pancreas, tirzepatide slows gastric emptying via vagal afferent signaling, trimming postprandial glucose and moving satiety forward. That gut-level brake is one of the quiet workhorses behind the weight data.
Appetite itself runs through the brainstem. Research indicates GLP-1 receptor agonism activates cholecystokinin neurons there to suppress hunger, while GIP receptor activation modulates the same circuit and attenuates the nausea usually attached to GLP-1-based therapies [PMID: 34844019, 34380697]. That may be why tolerability looks better than dose-matched selective GLP-1 approaches.
One more layer sits beneath that: GIPR also contributes weight-independent insulin sensitization. Studies in obese mouse models showed GIPR agonism improves insulin sensitivity in ways not explained by weight loss alone PMID: 34003802 .
Beyond that, long-acting GIP receptor activation appears to rewire adipocyte nutrient metabolism, with research pointing to influence over lipid storage and mobilization in adipose tissue PMID: 38878772 . All of which sets up the question with real numbers behind it: what do the human trials show?
- Dual agonism at GIP and GLP-1 receptors with imbalanced biased signaling favoring GIPR engagement, enhancing insulin secretion in a glucose-dependent manner
- Suppression of glucagon secretion via GLP-1 receptor activation on pancreatic alpha cells during hyperglycemia
- Slowing of gastric emptying contributing to postprandial glucose reduction and increased satiety
- Central appetite suppression via brainstem circuits, modulated by GIP receptor activation attenuating GLP-1-induced nausea
- GIPR-mediated weight-independent insulin sensitization and adipocyte nutrient metabolism modulation
Research Findings
The human evidence is unusually thick. In SURPASS-1, tirzepatide monotherapy in type 2 diabetes drove dose-dependent HbA1c drops up to 1.87% at 15 mg, with mean weight loss up to 11.0 kg over 40 weeks PMID: 34186022 .
Then SURPASS-2 went head-to-head with the reigning selective GLP-1 option: tirzepatide 15 mg cut HbA1c by 2.58% versus 1.74% for semaglutide
Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 1 mg — noninferior, and actually superior on glycemia, with greater weight loss to match PMID: 34370970 .
Obesity is where the numbers get dramatic. SURMOUNT-1 enrolled adults without diabetes, BMI 30 or above (or 27 with comorbidities), and at 72 weeks mean weight loss reached 15.0% at 5 mg, 19.5% at 10 mg, and 20.9% at 15 mg — against 3.1% with placebo PMID: 35210595 .
Those figures exceeded anything previously reported for an approved obesity pharmacotherapy. And after an intensive lifestyle intervention, SURMOUNT-3 showed additional reductions of 18.4% and 24.2% (10 mg, 15 mg) versus 2.7% with placebo at 72 weeks PMID: 37840095 .
Glycemia and weight aren't the whole story. A pre-specified meta-analysis of SURPASS found no increased cardiovascular risk and signals of benefit, including systolic blood pressure reductions of 5.4 to 8.5 mmHg across doses PMID: 35210595 . Lipoprotein profiles improved too, with triglycerides, VLDL cholesterol, and apolipoprotein C-III all trending down PMID: 33462955 .
Two substudies push further: the SURPASS-3 MRI substudy reported reductions in liver fat and abdominal adipose tissue versus insulin degludec PMID: 35468325 , while SURPASS-4 kidney analyses showed slowed albuminuria progression versus insulin glargine PMID: 36152639 .
And the head-to-head that settled the class rivalry: in SURMOUNT-5, tirzepatide produced 20.2% weight loss versus 13.7% for semaglutide
Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 2.4 mg at 72 weeks PMID: 40353578 . It's a result that reframes the old GLP-1-only ceiling — and raises the natural question of dose and protocol details.
- blood-sugar-control clinical
- fat-loss clinical
- metabolic-health clinical
- cardiovascular-health clinical
Dosage Context Explained
The approved regimen starts small on purpose: 2.5 mg subcutaneously once a week for four weeks, then 5 mg. From there it climbs in 2.5 mg steps at minimum four-week intervals up to a ceiling of 15 mg weekly.
Where maintenance lands depends on the goal: 5, 10, or 15 mg weekly for type 2 diabetes under Mounjaro, tuned to individual needs — and the same maintenance trio for weight management under Zepbound, guided by weight loss response and tolerability.
Injection is practical rather than fussy: abdomen, thigh, or upper arm, with site rotation encouraged, and dosing can happen any time of day, independent of meals. The laddering is why gastrointestinal events stay mostly manageable — they cluster in the early escalation phase.
The five-day half-life buys schedule flexibility: the once-weekly rhythm can drift up to four days, as long as doses stay at least three days apart. That's the practical portrait — now for the research lens on what titration actually targets.
The dose-response story comes from a phase 2 study: HbA1c reductions plateaued between 10 mg and 15 mg, while weight loss kept climbing dose-dependently up to 15 mg PMID: 33325008 . That's why every SURPASS trial stacked 5, 10, and 15 mg as the functional doses — 2.5 mg served only as the mandatory start.
One caveat defines this section: any use outside approved indications remains investigational, and every number here comes from populations meeting strict trial enrollment criteria. Keep those boundaries in mind when the side-effect profile — always the next question — gets discussed.
-
- Administration Routes
- subcutaneous
- Range
- 2.5 mg, 5 mg, 10 mg, 15 mg once weekly
FDA-approved dosing: 2.5 mg starting dose titrated to 5 mg, 10 mg, or 15 mg once weekly for type 2 diabetes (Mounjaro) and obesity (Zepbound)
Reconstitution Calculator
Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.
Side Effects: Research Context
The class signature is gastrointestinal — and it was predictable given GLP-1 activation. Across SURPASS and SURMOUNT, nausea hit 5-18% depending on dose, diarrhea 5-17%, decreased appetite 5-11%, vomiting 2-9%, constipation 4-7%, and dyspepsia 3-5%, with injection site reactions in roughly 2-5%.
Mild to moderate in severity, they peak while the dose climbs and typically clear within four to eight weeks of starting a new level [PMID: 34186022, 35210595]. That trajectory sets up the most intriguing part of the GI story.
The intriguing part: GIP receptor activation dampens GLP-1-induced nausea and emesis at the brainstem level, which may explain comparable or lower rates than selective GLP-1 agonists even where weight loss ran higher PMID: 34380697 . Tolerability here isn't luck; it looks engineered.
Glycemia safety deserves its own line: in SURPASS-5, tirzepatide added to insulin glargine showed rare hypoglycemia below 54 mg/dL, at placebo-level rates when background insulin was appropriately titrated PMID: 35133415 .
Across the development program, no clinically significant changes in heart rate, pancreatitis, or thyroid C-cell malignancy were observed. What remains is a boxed warning on thyroid C-cell tumors based on rodent studies, plus contraindications for a personal or family history of medullary thyroid carcinoma or MEN 2.
That warning is why the regulatory picture matters so much here — a compound with real approvals and a real boxed warning.
- nausea
- diarrhea
- decreased appetite
- vomiting
- constipation
- dyspepsia
- abdominal pain
- injection site reactions
Frequently Asked Questions
Frequently Asked Questions
-
Tirzepatide activates both GIP and GLP-1 receptors, while semaglutide targets only the GLP-1 receptor. That dual mechanism matters because the pathways complement each other: GIP receptor activity enhances insulin secretion and modulates how fat cells handle nutrients, while GLP-1 receptor activation suppresses glucagon, slows gastric emptying, and reduces appetite centrally. Head-to-head data backs the difference up: in SURPASS-2 tirzepatide achieved larger HbA1c reductions than semaglutide 1 mg, and in SURMOUNT-5 it produced 20.2% weight loss versus 13.7% for semaglutide 2.4 mg at 72 weeks [PMID: 34370970, 40353578]. GIP receptor activation also appears to soften the nausea typically tied to GLP-1-based therapies, which may make tirzepatide easier to tolerate at higher doses.
-
SURMOUNT-1, in adults with obesity but no diabetes, delivered mean reductions of 15.0% at 5 mg, 19.5% at 10 mg, and 20.9% at 15 mg, against 3.1% with placebo over 72 weeks — outperforming anything previously reported for an approved obesity pharmacotherapy. When tirzepatide followed an intensive lifestyle intervention in SURMOUNT-3, the additional reductions reached 18.4% and 24.2% at 10 mg and 15 mg versus 2.7% with placebo. The direct comparison in SURMOUNT-5 saw tirzepatide hit 20.2% against 13.7% for semaglutide 2.4 mg at 72 weeks [PMID: 35210595, 37840095, 40353578].
-
Most reported side effects are gastrointestinal: nausea, diarrhea, decreased appetite, vomiting, constipation, and dyspepsia, with injection site reactions in a small minority of participants. In the SURPASS and SURMOUNT programs, nausea occurred in 5-18% of participants depending on dose, diarrhea in 5-17%, and the rest followed in similar ranges. These events are typically mild to moderate, concentrate during dose escalation, and resolve within about four to eight weeks of starting a new dose level [PMID: 34186022, 35210595]. GIP receptor co-agonism may help mitigate nausea relative to selective GLP-1 receptor agonists. Note also that tirzepatide carries a boxed warning on thyroid C-cell tumors based on rodent studies, even though no such events appeared in the clinical trials.
-
Tirzepatide is FDA-approved in the United States for type 2 diabetes, as Mounjaro since May 2022, and for chronic weight management, as Zepbound since November 2023; both are available by prescription. The European Medicines Agency authorized it for type 2 diabetes in 2022 and for weight management subsequently, and the UK MHRA has granted similar approvals; in the EU it is marketed as Mounjaro for both indications. It is a once-weekly subcutaneous injection, titrated from 2.5 mg up to a maximum of 15 mg. Use outside approved indications should be treated as investigational, and readers should review our disclaimer page for the full legal picture before acting on anything.
-
Roughly five days, on average. The C-20 fatty diacid conjugated to lysine at position 20 binds albumin in the subcutaneous compartment, which stretches the molecule's half-life to about five days and makes once-weekly dosing possible. That half-life also buys scheduling slack: the weekly injection can be moved by up to four days, so long as at least three days separate consecutive doses.
-
Through the brainstem, primarily. Research indicates GLP-1 receptor activation switches on cholecystokinin neurons in the brainstem that suppress appetite, while GIP receptor activation modulates that same circuit and blunts the nausea and aversive effects commonly seen with GLP-1 analogues [PMID: 34844019, 34380697]. Slower gastric emptying adds a gut-level contribution, trimming postprandial glucose and moving satiety forward. It is one reason brain-level and gut-level signals pull in the same direction.
Related Pages
- Tirzepatide vs Retatrutide
Comparison