Skip to content

Research Guide

GLP-1 Peptides Research Guide

Research overview of GLP-1 agonists: how semaglutide, tirzepatide, and retatrutide differ on receptors, weight-loss data, and practical comparison points.

Last updated Jun 11, 2026 11 min read

he discovery that gut-derived peptides could regulate blood glucose and appetite — a finding that earned the 2024 Nobel Prize in Physiology or Medicine for the identification of GLP-1 — has reshaped metabolic research in ways few anticipated. What began as an investigation into incretin hormones has produced a class of compounds that now represents the most actively studied area in obesity and type 2 diabetes research.

GLP-1 (glucagon-like peptide-1) is a 31-amino-acid incretin hormone released from intestinal L-cells in response to nutrient ingestion. Its primary metabolic role is glucose-dependent: it stimulates insulin secretion from pancreatic beta cells when blood glucose is elevated, while simultaneously suppressing glucagon release from alpha cells PMID: 37952131 . This glucose-dependent mechanism means GLP-1 receptor activation does not provoke insulin release when glucose levels are normal — a safety feature that distinguishes it from exogenous insulin administration.

The native GLP-1 molecule, however, is impractical as a therapeutic tool. Dipeptidyl peptidase-4 (DPP-4) cleaves it within minutes, producing a half-life of approximately 2 minutes in circulation. The entire history of GLP-1-based drug development is, in essence, a series of engineering solutions to this instability problem — each producing compounds with progressively longer half-lives, greater receptor potency, and broader metabolic effects.

Three compounds represent the current frontier of this engineering effort. Semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization , a modified GLP-1 analogue with a half-life of approximately one week, established the therapeutic viability of once-weekly GLP-1 receptor agonism. Tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity extended the concept by adding a second receptor target — the GIP (glucose-dependent insulinotropic polypeptide) receptor — creating a dual agonist that produces greater metabolic effects than GLP-1 receptor activation alone. Retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease pushed the architecture further still, adding glucagon receptor agonism to the GIP and GLP-1 targets, creating a triple receptor agonist that has produced the largest weight loss figures observed in clinical trials to date.

This guide examines what the published research reveals about each compound's mechanism, clinical evidence, and position within the evolving landscape of incretin-based metabolic research. All content reflects peer-reviewed findings and regulatory documentation; no medical advice is provided.

Overview

The incretin system is not a single pathway but an integrated network of hormonal signals that coordinate postprandial glucose disposal, appetite regulation, and energy metabolism. GLP-1 and GIP — the two primary incretin hormones — are released from the gut in response to nutrient ingestion and act on their respective receptors in the pancreas, brain, and peripheral tissues.

In healthy individuals, the incretin effect — the observation that oral glucose produces a significantly greater insulin response than intravenous glucose at matched plasma concentrations — accounts for approximately 50–70% of postprandial insulin secretion PMID: 21984584 . This effect is mediated by GLP-1 and GIP acting on pancreatic beta cells to potentiate glucose-stimulated insulin secretion.

GLP-1 receptor (GLP-1R) activation produces a cascade of metabolic effects beyond insulin secretion. In the central nervous system, GLP-1R signaling in the hypothalamus and brainstem suppresses appetite through modulation of pro-opiomelanocortin (POMC) and cocaine-and-amphetamine-regulated transcript (CART) neurons, while inhibiting the orexigenic neuropeptide Y (NPY) and agouti-related peptide (AgRP) circuits PMID: 39728000 . In the stomach, GLP-1R activation delays gastric emptying, contributing to postprandial satiety. In the liver and adipose tissue, GLP-1 signaling activates AMPK/SIRT1 pathways associated with metabolic homeostasis and adipose tissue browning.

GIP receptor (GIPR) agonism adds a complementary dimension. While GIP was historically considered less important than GLP-1 for glucose control — partly because its insulinotropic effect is diminished in type 2 diabetes — recent research has revealed that GIPR activation in adipose tissue improves lipid metabolism and nutrient partitioning in ways that are independent of its pancreatic effects PMID: 34003802 . Additionally, GIPR signaling in the brain appears to attenuate the nausea commonly associated with GLP-1 receptor activation, potentially allowing higher effective doses.

Glucagon receptor (GCGR) agonism might seem counterintuitive in a metabolic drug — glucagon raises blood glucose, the opposite of what diabetes therapy aims to achieve. However, at the doses used in triple agonism, glucagon receptor activation stimulates hepatic fatty acid oxidation and increases energy expenditure, producing a catabolic signal in the liver that complements the anabolic, glucose-lowering effects of GLP-1 and GIP signaling PMID: 37366315 . This thermogenic component is what gives triple agonists their distinctive metabolic profile.

The progression from single (GLP-1) to dual (GLP-1/GIP) to triple (GLP-1/GIP/glucagon) agonism reflects a deeper understanding of metabolic regulation. Each receptor adds a layer of metabolic activity that the others do not provide. Whether this added complexity produces proportionally greater clinical benefit — and whether the safety profile remains acceptable — is the central question driving current research.

Quick Comparison

Compound Mechanism Research Status
Semaglutide GLP-1R activation, central appetite suppression, gastric emptying delay FDA/EMA/MHRA approved
Tirzepatide Dual GIP/GLP-1R agonism, biased signaling toward GIPR FDA/EMA/MHRA approved
Retatrutide Triple incretin agonism — GLP-1R + GIPR + GCGR Phase 3 clinical (investigational)

Compounds in This Guide

Semaglutide

GLP-1 receptor agonist for appetite regulation and metabolic optimization

Full profile →

Semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization is a modified GLP-1 analogue — a 31-amino-acid peptide with three specific structural modifications that extend its half-life from the native 2 minutes to approximately one week. An aminoisobutyric acid (Aib) substitution at position 8 protects against DPP-4 cleavage. An Arg34 substitution alters receptor binding kinetics. And a C18 fatty diacid chain attached via a linker to lysine at position 26 enables non-covalent binding to serum albumin, which shields the peptide from renal clearance and enzymatic degradation PMID: 37952131 .

These modifications produce a compound with a molecular weight of 4,113.6 Da and a half-life of approximately 168 hours (7 days), enabling once-weekly subcutaneous administration. An oral formulation (Rybelsus) uses sodium N-[8-(2-hydroxybenzoyl)amino] caprylate (SNAC) as an absorption enhancer to achieve sufficient bioavailability through the gastrointestinal tract.

**The clinical evidence for semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization is the most extensive of any GLP-1 receptor agonist.** The STEP (Semaglutide Treatment Effect in People with obesity) trial program enrolled over 17,000 participants across multiple phase 3 studies. STEP 1 demonstrated mean body weight reduction of 14.9% at 68 weeks with once-weekly subcutaneous semaglutide 2.4 mg versus 2.4% with placebo PMID: 33567185 . The SUSTAIN trial program in type 2 diabetes demonstrated HbA1c reductions of 1.5–1.8% across studies, with superiority over multiple active comparators.

Beyond glycemic control and weight loss, the SELECT trial (2023) demonstrated that semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 2.4 mg reduced major adverse cardiovascular events (MACE) by 20% in adults with overweight or obesity and established cardiovascular disease — the first GLP-1 receptor agonist to demonstrate cardiovascular risk reduction in a non-diabetic population PMID: 37952131 . This finding expanded the therapeutic narrative beyond diabetes and obesity into cardiovascular risk management.

Semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 's mechanism of appetite suppression operates through central nervous system pathways. GLP-1 receptor activation in the hypothalamus modulates POMC/CART neurons (anorexigenic) and NPY/AgRP neurons (orexigenic), shifting the balance toward reduced food intake PMID: 39728000 . Delayed gastric emptying contributes to postprandial satiety, though this effect may attenuate with chronic use.

Additional mechanisms under investigation include NF-κB inhibition and anti-inflammatory macrophage modulation PMID: 39728000 , AMPK/SIRT1 pathway activation and adipose tissue browning, and SIRT1/NRF2 antioxidant pathway activation — suggesting effects that extend beyond appetite suppression into cellular metabolic regulation.

**The regulatory status of semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization is unambiguous.** It holds FDA, EMA, and MHRA approval for type 2 diabetes (Ozempic, Rybelsus) and chronic weight management (Wegovy). It is classified as Phase 4 (post-marketing) in clinical development, representing the most mature compound in the GLP-1 agonist class.

weight-loss glycemic-control cardiovascular-risk-reduction appetite-regulation

Tirzepatide

Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity

Full profile →

Tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity is a dual GIP/GLP-1 receptor agonist — a 39-amino-acid linear peptide engineered from the native GIP sequence with structural modifications that enable simultaneous activation of both the GIP and GLP-1 receptors. A C-20 fatty diacid moiety conjugated to lysine at position 20 provides albumin binding for extended half-life, while an aminoisobutyric acid substitution at position 2 protects against DPP-4 degradation PMID: 32730231 .

The molecular weight is 4,813.5 Da with a half-life of approximately 5 days. The compound is administered once weekly by subcutaneous injection. Its amino acid sequence — YAibEGTFTSDVSSYLEEQAAKEFIAWLVKGRG-OH — is publicly documented, distinguishing it from retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease whose sequence remains proprietary.

**What distinguishes tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity mechanistically is its imbalanced biased signaling.** While it activates both GIP and GLP-1 receptors, its signaling profile is skewed toward GIPR engagement. This bias is not accidental but engineered: tirzepatide's binding affinity and intracellular signaling cascade produce greater GIPR-mediated effects relative to GLP-1R effects than would be predicted from equipotent dual agonism PMID: 34003802 . This design reflects the hypothesis that GIPR activation contributes metabolic benefits — particularly in adipose tissue nutrient metabolism and insulin sensitization — that are underexploited by pure GLP-1 receptor agonists.

The clinical evidence for tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity is substantial. The SURPASS trial program in type 2 diabetes demonstrated HbA1c reductions of 2.0–2.4% across studies, with superiority over semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 1 mg in head-to-head comparison [PMID: 34186022, PMID: 34370970]. The SURMOUNT trial program in obesity demonstrated mean body weight reductions of 15–22.5% depending on dose (5–15 mg), with the highest dose producing the largest weight loss observed with any approved medication at the time of publication PMID: 35133415 .

A key safety-related mechanism is GIP receptor-mediated attenuation of GLP-1-induced nausea. Research suggests that GIPR activation in the brainstem circuits responsible for nausea signaling may partially counteract the emetic effects of GLP-1R stimulation [PMID: 34844019, PMID: 34380697]. This anti-emetic complementarity is hypothesized to allow higher effective GLP-1R engagement without proportional increases in gastrointestinal side effects — a significant clinical advantage.

GIPR activation also contributes weight-independent insulin sensitization and adipocyte nutrient metabolism modulation [PMID: 34003802, PMID: 38878772]. This distinguishes tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity from pure GLP-1 receptor agonists, which primarily achieve metabolic improvement through weight loss and glucose-dependent insulin secretion.

Tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity holds FDA approval as Mounjaro (type 2 diabetes) and Zepbound (chronic weight management), as well as EMA and MHRA authorization. It is classified as a clinical-stage compound in active post-marketing surveillance.

blood-sugar-control fat-loss metabolic-health cardiovascular-health

Retatrutide

Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease

Full profile →

Retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease is a triple incretin receptor agonist — the first compound engineered to simultaneously activate GLP-1, GIP, and glucagon receptors with a single molecule. Developed by Eli Lilly, retatrutide represents the furthest extension of the incretin engineering paradigm: adding hepatic glucagon receptor signaling to the metabolic portfolio of GIP and GLP-1 receptor activation.

The compound's amino acid sequence remains proprietary and has not been publicly disclosed. Its half-life is approximately 6 days, enabling once-weekly subcutaneous administration. It is currently in Phase 3 clinical development and is not approved by any regulatory agency.

The rationale for adding glucagon receptor agonism is rooted in the distinct metabolic effects of hepatic GCGR activation. While GLP-1 and GIP signaling primarily improve glucose disposal and suppress appetite, glucagon receptor activation stimulates hepatic fatty acid oxidation, increases energy expenditure, and promotes lipolysis PMID: 37366315 . At the doses used in triple agonism, the net effect is a catabolic signal in the liver that enhances the overall metabolic impact beyond what incretin signaling alone can achieve.

The clinical data for retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease is striking. The Phase 2 trial (published 2023) enrolled adults with obesity and demonstrated mean body weight reductions of up to 24.2% at 48 weeks with the highest dose (12 mg once weekly) — the largest weight loss figure reported in any clinical trial of an anti-obesity medication at the time of publication PMID: 37366315 . These results exceeded both semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization 2.4 mg and tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity 15 mg in cross-trial comparisons, though direct head-to-head trials had not been conducted.

The Phase 2 trial also demonstrated significant improvements in cardiometabolic markers. Liver fat content was reduced by up to 80% in participants with metabolic dysfunction-associated steatotic liver disease (MASLD), suggesting potential therapeutic relevance for a condition with limited treatment options PMID: 37385280 . HbA1c reductions of up to 2.0% were observed in participants with type 2 diabetes.

**The safety profile of retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease mirrors that of GLP-1 receptor agonists broadly.** Gastrointestinal adverse events — nausea, diarrhea, constipation — were the most commonly reported, generally mild to moderate in severity, and most frequent during dose escalation. The glucagon receptor agonism component did not produce clinically significant hyperglycemia, consistent with the hypothesis that the glucose-elevating effects of glucagon are offset by the insulinotropic effects of GLP-1 and GIP signaling.

Multiple Phase 3 trials (TRIUMPH program) are underway evaluating retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease for obesity, type 2 diabetes, and metabolic dysfunction-associated steatohepatitis (MASH). If Phase 3 results confirm Phase 2 findings, retatrutide could become the most potent weight management medication in clinical development.

** Retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease is classified as investigational.** It is not approved by the FDA, EMA, or MHRA. Its use is restricted to clinical trial settings. As a proprietary compound, research-grade material is not commercially available in the same manner as research peptides.

fat-loss metabolic-health liver-health glucose-regulation

Frequently Asked Questions

Frequently Asked Questions

Summary

Semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization , tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity , and retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease represent three successive generations of incretin-based engineering — each expanding the receptor target portfolio and producing progressively greater metabolic effects. Semaglutide validated once-weekly GLP-1 receptor agonism as a viable therapeutic strategy. Tirzepatide demonstrated that adding GIP receptor activation could surpass the efficacy of GLP-1 receptor agonism alone. Retatrutide has shown that adding glucagon receptor activation can push the boundaries of metabolic efficacy further still.

What the clinical evidence consistently demonstrates is a dose-response relationship between receptor target breadth and metabolic potency. The progression from single to dual to triple agonism has produced incrementally greater weight loss and glycemic improvement in clinical trials. Whether this progression has reached its ceiling — or whether additional receptor targets (such as amylin or PYY receptors) will be incorporated into future designs — remains an open research question.

The cardiovascular implications are significant. The SELECT trial's demonstration that semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization reduces MACE in non-diabetic adults with obesity established GLP-1 receptor agonism as a cardioprotective intervention. Whether tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity and retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease will demonstrate comparable or greater cardiovascular benefit through their broader receptor profiles is a question that ongoing trials aim to answer.

For researchers evaluating these compounds, the primary literature — peer-reviewed studies indexed in PubMed — remains the authoritative source. Key PubMed IDs referenced in this guide include PMID: 37952131 and PMID: 33567185 for semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization ; PMID: 32730231 , PMID: 34003802 , and PMID: 35133415 for tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity ; and PMID: 37366315 and PMID: 37385280 for retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease .

For comparisons between individual compounds, see [ Semaglutide Semaglutide Semaglutide GLP-1 receptor agonist (incretin mimetic) GLP-1 receptor agonist for appetite regulation and metabolic optimization vs Tirzepatide Tirzepatide Tirzepatide dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist Dual GIP/GLP-1 receptor agonist studied for type 2 diabetes and obesity ](/en/compare/semaglutide-vs-tirzepatide/) and [ Retatrutide Retatrutide Retatrutide triple incretin receptor agonist (GLP-1/GIP/glucagon) Triple receptor agonist (GLP-1/GIP/glucagon) studied for obesity, type 2 diabetes, and metabolic disease vs Semaglutide](/en/compare/retatrutide-vs-semaglutide-weight/). For weight loss-focused research involving these compounds alongside other metabolic peptides, see the Weight Loss Peptides Guide.