Chemistry data
- Class
- naturally occurring 43-amino acid actin-sequestering peptide
- Molecular weight
- 4921 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids, acetylated N-terminus)
- Half-life
- estimated 2–6 hours in circulation (rapidly distributed to tissues)
- Routes
- ophthalmic (eye drops — RGN-259 clinical formulation) · topical · subcutaneous · intravenous
- Studied doses
- ophthalmic 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation) · topical varies by study; typically applied directly to wound site in preclinical models
Stato Normativo
- Stati Uniti
- investigational_new_drug
- Unione Europea
- investigational
- Regno Unito
- investigational
Come funziona
- G-actin sequestration and cytoskeletal regulation
- Angiogenesis promotion via VEGF and HIF-1α pathways
- Anti-inflammatory action (NF-κB suppression, cytokine modulation)
- Anti-apoptotic signaling and cell survival promotion
- Stem/progenitor cell mobilization and differentiation
- Extracellular matrix remodeling and collagen regulation
Risultati della ricerca
- wound-healing clinical
- corneal-repair clinical_phase_3
- cardiac-repair preclinical
- anti-inflammatory preclinical
- hair-growth preclinical
Contesto di dosaggio
-
- Vie di Somministrazione
- ophthalmic
- Intervallo
- 0.1% RGN-259 solution, applied as eye drops (clinical trial formulation)
Phase 3 clinical trials for neurotrophic keratopathy and dry eye disease
-
- Vie di Somministrazione
- topical
- Intervallo
- varies by study; typically applied directly to wound site in preclinical models
animal wound-healing studies
🧮 Reconstitution Calculator
Determine exactly how much bacteriostatic water to add and how many units to draw for your target dose.
Effetti collaterali: contesto di ricerca
- generally well-tolerated in clinical trials (ophthalmic formulation)
- mild ocular discomfort reported in some RGN-259 trial participants (self-resolving)
- no serious adverse events attributed to Tβ4 in published Phase 3 data
Il riassunto completo della ricerca arriverà presto. Nel frattempo, consulta i dati scientifici e i riferimenti PubMed sopra.
Pagine Correlate
- tb 500 vs thymosin beta 4
- tb 500
- wound healing
- corneal repair
- cardiac repair
- healing stack
- healing peptides
- thymosin beta 4
- TB-500
Systemic tissue repair & angiogenesis
- BPC-157
Gastrointestinal protection & systemic tissue repair
- GHK-Cu
Skin regeneration & collagen synthesis